DPCstruct | MC34884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 21.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7Z333 | 10-188 | LTKAAGISFLYAPGEGDVEPGDSSEGAGGGGSEAEDPGDAEDQEDREDSVDAEQDGGKGSDDQAEGILDFLKSTQEMYFYDGVSKGL… |
| A0A4X2KRW3 | 150-307 | ISKNKKRKLKKKQQKERKRAAGLLTKATGISFTYQPESSSEGEDSKDTNEKADGILDFLQATQEIYFSDSNFKSSDSTVCLETIQEI… |
| A0A6P6BSL7 | 222-375 | None |
| A0A7J8DXT6 | 1-191 | None |
| A0A2J8TF27 | 297-480 | None |
| A0A7F8KCL5 | 41-190 | None |
| A0A834DL98 | 24-197 | None |
| A0A6A1QAG5 | 163-345 | None |
| G3TD95 | 51-230 | None |
| F6XEY7 | 63-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.