DPCstruct | MC34882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F1L6F6 | 1-80 | MNNKLSREELIDLVNIIMNSGVDSKTGKEYTDSEVIRMVQIFESNITSPDGSDLIFYPDLCGLKIDASAEEIVDAGLNYK |
| A0A1H3M0A0 | 1-67 | MKTIKTRDELVEIVRKIMNSEGTEEELDEMIDLFNQNVPHPEASDLIFWDNRNLTVEEIVEEALNYK |
| A0A1G4EKN3 | 60-133 | None |
| B0C5P4 | 3-74 | None |
| A0A0Q5E867 | 81-155 | None |
| R5V1E6 | 1-68 | None |
| A0A2T5XYA7 | 1-78 | None |
| A0A1H5ZDJ0 | 84-153 | None |
| A0A0A6UGY7 | 12-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.