DPCstruct | MC3488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2NGS2 | 17-90 | KKQKLSFDTGTGTFTKGLMVSGATSKATAVIDKVSGSTSGYLVLKNVTGTFQNDEALTDTGTGAAVANGVCSDY |
| A1AMI4 | 23-94 | DTKQKITEKRGSFQQGETVRLSPSGAVARYTTTHWFPIYGYHLYLVPLSGTPQAGDLITGTVSGATARIDYT |
| A0A4R8F8R5 | 850-922 | None |
| A0A3S9EAR8 | 444-516 | None |
| A0A1V5ZLI0 | 445-525 | None |
| A0A1Z9DJR5 | 524-605 | None |
| A0A420YZK9 | 400-478 | None |
| A0A1Z9F1Q6 | 52-129 | None |
| A0A0F9UF04 | 653-727 | None |
| A0A519D6T3 | 41-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.