DPCstruct | MC34879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496WZL0 | 1-116 | MYTMENYFWGVVAYVLGVFMFMPLLWWVTRIIPWHPVKAFLRILVMAILLTPAFPYPGMTYIAPAWAVSLFEMVKPQTENGVWRGIR… |
| A0A1I6GWY5 | 1-121 | MVESMVIAGLDAETQTAYALFWGIYVVGFVLFYWAMSRLIRWIPLYGLRTLVKALLIVVIATPVQSTVVDGWWVPAWLFGGYETLMG… |
| A0A2E0A767 | 1-105 | None |
| A0A0P9XQV4 | 716-845 | None |
| A0A3L8C2Y9 | 1-115 | None |
| A0A2H0DDW6 | 3-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.