DPCstruct | MC34875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8PMR2 | 56-160 | EPRIDEATLLAVQQQMVQQAAFAQIPDVVKRFIVHFHHAVLENNLAEITAAYESGWNRLTEKFYSKTEWPEAEVIAPLVNDDQIFLI… |
| A0A2H1CPZ6 | 1-104 | MPSDAYAVLKEDVRSFICSFYVHLKEKNITEIESDYQTKFPRLTEQYFVSTRWPSAEIVSKLVDKDPLFLMLYNELYYRHVYAHVSM… |
| A0A453FPB9 | 1-118 | None |
| F0WLC0 | 2-105 | None |
| A0A0R3QW67 | 9-118 | None |
| A0A086L4V3 | 65-173 | None |
| A0A2J8A3H2 | 3-105 | None |
| A0A1Q9D3G5 | 626-733 | None |
| A0A453EHS7 | 54-164 | None |
| A0A453EHT0 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.