DPCstruct | MC34873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 231 ± 16 aa |
| Standard deviation of domain lengths | 15.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1EHJ7 | 48-271 | SISGRVYDLCHAPQSVSALLAEDPALPPADALKRLYSHHAVGVLESAPPKHRRTATPEELDRAASCGSFGDTRPSELFLRVWHDALC… |
| B8PF09 | 1-261 | MTSERVYHLTHSDKTLTAAFATSPDSSPGELGKTLYAEHHHGIHKPNATGGITATIRDMLKTGHAPDEAKEAVREDDPTPEDLDRAA… |
| Q5B1M6 | 468-686 | None |
| A0A177A2S7 | 25-248 | None |
| A0A395IMJ0 | 1-224 | None |
| A0A1B8F1H9 | 1-225 | None |
| A0A6V8R447 | 1-270 | None |
| A0A1J8Q9S7 | 408-646 | None |
| Q0CY91 | 53-263 | None |
| A7F8W8 | 1-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.