DPCstruct | MC34872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 16.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165UIY3 | 45-165 | NEVWNAAESFWQQKYNHWTRPSLGLILGCALVQHKTQSGRSLPGVDQLFRILISQSAFLIWKLRCERVITHPDEEHSAPAIVNRWTS… |
| B8PEX1 | 75-217 | QEVWTLAQSTWERRGIPWPALSWGLLLGCGLIGFRSTEKKLRRGPTRLYRILVTEAALLIWNLRSRRTFRPGQAGADMQVLWRTSLK… |
| A0A2H3CGS8 | 138-254 | None |
| A0A6A4GDU4 | 104-247 | None |
| A0A5B1QYG3 | 141-286 | None |
| A0A4Y9Z5S9 | 603-756 | None |
| A0A0C9UQG8 | 1-107 | None |
| A0A5M3N538 | 135-289 | None |
| D6RPA2 | 12-165 | None |
| A0A0C9VME0 | 14-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.