DPCstruct | MC34866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 265 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7UZL4 | 236-536 | PFLTAWDEKYRDHGLVIIGVHTPEFEFEKRLDNVRAANAEHGVEYLVAIDNDYATWRAFQGRRGFWPRKFLIGPTADGSPMGVRYDH… |
| A0A7J4J8I1 | 35-294 | PYLTTWHNKYKNKGLLIIGVHTPEFDFEKEYDNVVRATKKWDLHYPIILDNDHQTWRAYKNRYWPRKYLIDIDGFIVYDHIGEGSYA… |
| A0A7V0YH86 | 2-272 | None |
| A0A2R6AT44 | 6-244 | None |
| A0A832SBJ7 | 1-236 | None |
| A0A1F5RFR3 | 127-406 | None |
| A0A1H8U822 | 261-477 | None |
| A0A2H0BEY2 | 240-504 | None |
| A0A2E5LRM9 | 131-429 | None |
| A0A7X3VV13 | 108-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.