DPCstruct | MC3486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 215 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4J792 | 27-245 | MEAVWQDYWTFRDNALLAIAMVVNEQSYLEKRVVKNAKYQKEVLNTIEFKLQDMFLFNQILFPYEEGGGLQLAGQTLHAFGSLEERI… |
| A0A0D0FPW1 | 1-179 | MYSLIINEQNLIQEPIISKLFYQKKVFQTVPFYLQELFHFNAVIFPTCYGEIFGATVKKFVKLDQRIELGKKLAWILFDMGRLQTFI… |
| G9QII7 | 19-223 | None |
| A0A292YDR0 | 182-404 | None |
| A0A268E4W6 | 88-313 | None |
| A0A516KHP8 | 174-410 | None |
| A0A150KM45 | 1-168 | None |
| A0A0C2R9V2 | 126-351 | None |
| A0A3G3JT42 | 321-563 | None |
| A0A3T0KR51 | 67-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.