DPCstruct | MC34852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 207 ± 31 aa |
| Standard deviation of domain lengths | 30.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352IRT3 | 273-460 | GGNNFARSEPSLPPQPAPSDQEPSSEIGLKTFDEINESMSRMTGVPTTHSKVSEKFNTVRQQLPTVETIEGFLSSHQMAITQLAIQY… |
| A0A2E2UBY2 | 1-270 | MKTNNKAWARRLTGAISACAIMLMFNQCVQEYEEVQEVEFEKINMPNDDIHNDFTDDNPGGPIEEEADITPEEEKEKGATVAARTAA… |
| A0A4Q6EVH1 | 1-223 | None |
| A0A534CJS5 | 103-288 | None |
| A0A2H0PIT0 | 9-255 | None |
| A0A1X9NB72 | 180-397 | None |
| A0A3B1AAM7 | 722-900 | None |
| A0A7C1Y1D0 | 440-643 | None |
| A0A7X7PT82 | 235-407 | None |
| A0A2W4PZY9 | 577-755 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.