DPCstruct | MC34850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y1R4M0 | 14-105 | LEPYSTTGSAKFSTKSNPYLVKVGIPEFLNGIGNGVESHVSKLESEIGDFQKLLVTRTLKLKKLGIPCKHRKLILKYTHKYRLGLWR… |
| A0A1U8M400 | 1-81 | MMLILIVKVGIPEFLNGVGHGVETHVAKLESEIGDFQKLLVTRTLKLKKIGIPCKHRKLILKYAHKYRLGLWRPRAEPVKV |
| A0A6A6M3D9 | 80-173 | None |
| Q6IDB8 | 17-112 | None |
| A0A843UMA3 | 1-66 | None |
| A0A4Y1QXT5 | 62-151 | None |
| A0A2R6RFS4 | 16-110 | None |
| A0A0D3HB73 | 9-96 | None |
| A0A540L2P2 | 69-154 | None |
| A0A7N0VK52 | 56-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.