DPCstruct | MC3485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07659 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0FE14 | 8-92 | ERIIADTCDEIKNLLIRKNHDYGNSFSKQFEKYGLLSGIIRLDDKMSRLDSLIQNKALVNESIEDTVADIAGYAILLLIELRKKQ |
| A0A7V2JF30 | 1-83 | MKFEQIANEIVQLLERKNHDYGDSNLEIAGLYGIAVRIMDKVSRLAHLCFEEAQVDETVEDTLRDIAGYAINAIRLIRENRLK |
| A0A3N2L3E6 | 3-74 | None |
| A0A6I2R1X3 | 11-102 | None |
| A0A6L6YJH9 | 1-91 | None |
| A0A345C3K8 | 12-101 | None |
| A0A2E0S8V1 | 5-94 | None |
| A0A2J9PKH8 | 3-90 | None |
| A0A843HHI9 | 45-143 | None |
| A0A2U1K270 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.