DPCstruct | MC34846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 244 ± 42 aa |
| Standard deviation of domain lengths | 42.35 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9ZTD0 | 101-309 | HIPLPVYLLFDYELILLENTVFASCNAASAYVNFGKNFDFFKTMDWDKIFHRGSLHIEDTPLKREIISKRHAELLGLQDISLNYLNK… |
| A0A0R1ULX0 | 43-297 | RKQQALHANCPVPVFFIFKLPELLARPDVQFTDRSLALKQVVPRYHTPLEFSQLPFEDIYQEGPLIGLTSDQKKVITGRKQAEIIVP… |
| A0A2J6NPU3 | 248-534 | None |
| A0A813VKB0 | 705-971 | None |
| A0A1M4NB35 | 104-329 | None |
| A0A6G7C7C5 | 527-810 | None |
| A0A815MMN6 | 145-362 | None |
| A0A173ZGV5 | 2-214 | None |
| A0A0H4QLI9 | 75-342 | None |
| X6C5J6 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.