DPCstruct | MC34845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 178 ± 28 aa |
| Standard deviation of domain lengths | 28.10 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.91 |
| Pfam Score | 96.31 |
| Assigned Pfam label(s) | PF11164- CL0177- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022QK52 | 48-241 | SDLSRTEVDSLKARPRIDFSSIFSVVQPIVDDVRTRGDAAVKDYTRRFDKVELDTIVETVNDLPDPVLDPAVQEAFDVAYSNIYAFH… |
| A0A485BW80 | 26-189 | ISASDSITRTVAEILDNVKNNGDKALREYSAKFDKTEVGALQVTAEEIQQASDRLSDELKQAMQAAVRNIDTFHKAQILPPVDIETQ… |
| A0A7S4K8P1 | 83-262 | None |
| A0A0L8VW28 | 132-309 | None |
| A0A0A0LVH0 | 656-849 | None |
| A0A7C7DPR3 | 24-260 | None |
| A0A418WGJ6 | 227-426 | None |
| A0A520N1S0 | 18-188 | None |
| A0A6N7G0V8 | 26-171 | None |
| A0A316FPE0 | 9-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.