DPCstruct | MC34842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379V1X7 | 1-57 | MNLSRQEQRTLHVLAKGGRITHIRDASGRVTAVECYSREGLLLADCTLAVFKKLKTK |
| A0A485AN46 | 1-57 | MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGFLLSDCTLSVFKKLKTK |
| A0A2T7HAX7 | 1-58 | None |
| A0A7G3A1Y1 | 22-82 | None |
| A0A381GSF1 | 1-57 | None |
| A0A503ALJ2 | 2-50 | None |
| A0A2X2DUR8 | 1-53 | None |
| A0A2K8WFR8 | 1-57 | None |
| A0A7H4LZC0 | 1-52 | None |
| A0A7W6XPF6 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.