DPCstruct | MC34840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4FUI5 | 18-117 | FSVPAFCANPVSSDTGIGATLQQITEQYPIHFISIEQIVKELKNKPPMDVGFDIDDTIYYSTPAFIHGQRELSPKSNEFLKKSEFWD… |
| A0A2X1PWZ0 | 1-104 | MKNVMKLSVIALLTAAAVPAMAGKTEPYTQSGTNAREMLQEQAIHWISVDQIKQSLEGKAPINVSFDIDDTVLFSSPCFYHGQQKFS… |
| A0A2I8D719 | 30-131 | None |
| A0A2X3F0X6 | 1-105 | None |
| A0A0A2WD42 | 754-841 | None |
| A0A378MTI1 | 6-98 | None |
| A0A7U4UDJ0 | 12-104 | None |
| A0A0A8P239 | 1-118 | None |
| A0A6A5KVL5 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.