DPCstruct | MC3484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q0YRB0 | 2-96 | IRQKTAEHNLNNITRTAAYFTFFERHPEVHWAFLAHLVSRNGGWNMTDLRGSLLPLLLPEKTIAPLFLFLERANALIFHDAYPQLLL… |
| A0A0D0EYG1 | 1-116 | MNHDERQLIQHILQTTRKGNIDNISRTNCYESFYFRYQEIKWAFLAGLVSRNAGWNMCDLEGKSYSSLLTKQYRTYLFLTYERANWL… |
| W4QTU3 | 57-168 | None |
| G9QII6 | 14-155 | None |
| A0A1A5XR88 | 35-147 | None |
| A0A292YDR0 | 33-173 | None |
| A0A268E4W6 | 2-97 | None |
| A0A5S9MFA1 | 2-102 | None |
| A0A0C2R9V2 | 24-135 | None |
| A0A857MYP9 | 44-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.