DPCstruct | MC3483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 833 ± 84 aa |
| Standard deviation of domain lengths | 84.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D6DYX3 | 6-926 | LAREIQNGLKHFLTTGFEPSDPLFAGVMQRFTDDEGRWLKGPYIQIGLPFRTGTRGRSFFASFETEYPGHVHQEAAWQRLASRLDAA… |
| A0A090IWV4 | 7-834 | KFVKGPFIEITQPFIKGKNLMELIANGVISEEFFALKNHFPLERPLHIHQETAIKKVVEGRNIIVATGTGSGKTECFLLPILNELMR… |
| A0A8B4RT90 | 7-948 | None |
| G7F7Q0 | 1-694 | None |
| A0A318CS17 | 1-891 | None |
| A0A2R6EPD6 | 45-789 | None |
| A0A7C2DDW5 | 4-864 | None |
| A0A140K938 | 91-806 | None |
| A0A497TDY6 | 6-919 | None |
| A0A395M1Q5 | 1-818 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.