DPCstruct | MC34828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 232 ± 27 aa |
| Standard deviation of domain lengths | 27.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 87.78 |
| Assigned Pfam label(s) | PF03234- PF08564- PF08565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368F7K3 | 2-205 | TSFFDKNEGLIQEYGKLKTLEESEAFILEHPHLASEYTANYLTIDALNMAIDHKEEEMSNIARQCIVIQYLLELAKNMNAIPTNASI… |
| A0A818HHP8 | 112-355 | RPLDVDDLTHEGKSKTSINKKVTEERPKNMTEDEQAEYYKQFIEKHKANIKKFGMFRHYDDTQKFLEEHFELVCEETANYLVVWCID… |
| A0A1Y1WH43 | 1-188 | None |
| A0A219AP62 | 163-400 | None |
| A0A819TBR3 | 2-215 | None |
| A0A7R9YE37 | 231-460 | None |
| A0A0L0DR84 | 2-248 | None |
| A0A167FI12 | 139-420 | None |
| A0A673HYF1 | 88-335 | None |
| A0A7S2RVM9 | 278-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.