DPCstruct | MC34826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 232 ± 42 aa |
| Standard deviation of domain lengths | 42.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 64.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818H1V3 | 116-314 | LVTKWRNRLLSTTADLRLGQDRINDIDDLDIEQIILEAFNSAIDLIQHSKISTLLRKHDIFNIDSLSKYVHSQLNVNPKTFNTTQIT… |
| A0A818AKI8 | 11-199 | YNNKYSWDCHVVKVHDFLRRAQRLSLLNDIKCKQLHNGSVDKLVFSVHHKHRVERQSSFTRSQLEIDKIDIEQVITDAYHHAVDMLE… |
| A0A815DAA1 | 304-511 | None |
| A0A815IQM5 | 195-445 | None |
| A0A815J5M3 | 30-277 | None |
| A0A815Q516 | 1-190 | None |
| A0A815RT22 | 16-227 | None |
| A0A815VBR1 | 265-516 | None |
| A0A815SC11 | 397-649 | None |
| A0A821JTX5 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.