DPCstruct | MC34823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8DUJ6 | 194-248 | GSSDCLPGVFPAPCVRDPCDERSCKSHPNAICCPVYCGGCHDLWYVNGEKVACKK |
| A0A819DAA5 | 175-232 | KCQKNPTCPPGQTPVKCLKDPCQGAKCPAYPNAKCVSNYCGGCNALWYKADGTLVNCN |
| A0A835XRM5 | 233-306 | None |
| A0A2T7NM71 | 75-140 | None |
| A7S691 | 40-94 | None |
| A0A814UX96 | 146-197 | None |
| A0A820K0K8 | 36-90 | None |
| A0A814Y458 | 301-360 | None |
| A0A821A093 | 21-83 | None |
| A0A818CNB0 | 18-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.