DPCstruct | MC34822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 460 ± 82 aa |
| Standard deviation of domain lengths | 81.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0028- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5WA40 | 460-917 | VISHGNGHVYTWYDYLGTHLASYGYVVMSHQNNTQPGIESASTTTLTNTDYILSNLATIGGGVLNGHIDTGRIIWIGHSRGGEGVVR… |
| A0A818GSA3 | 31-448 | VSIDENFLNGAPFFFSTGYGKISKIKKYNFGSNNAPEFIARSIIILETLQQFRLWNEQKTNEFYNKLDLTNIGLMGHSRGGEAIVIA… |
| A0A1H0RN90 | 6-319 | None |
| A0A4Q6FUJ7 | 1-381 | None |
| A0A820C568 | 2-381 | None |
| A0A3A0C5G5 | 594-1112 | None |
| A0A315WM10 | 83-572 | None |
| A0A7C7DW27 | 93-581 | None |
| A0A2L0F4T5 | 605-1161 | None |
| A0A1D7QWG3 | 280-751 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.