DPCstruct | MC34821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 258 ± 38 aa |
| Standard deviation of domain lengths | 37.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1AXR2 | 85-342 | NEAGLLDLLKAVQDFLPKSTERGASDKTSPAHQQAIAFQEVLELTQRKLLRHISMYSETMDIEPFPRLVLVDIKDDDKKTEKRNTKS… |
| A0A818GNW7 | 1-255 | MNKKTDIILANTQETLIRIKHVMTQMYELHEYTTPRYFFILPVKHHNWTSINTIQNLFLLHYKLYFLCECSDEPDKLHIAPHDGYSI… |
| A0A1Y2G5B1 | 230-495 | None |
| A0A813Z540 | 432-690 | None |
| A0A821IM94 | 1-234 | None |
| A0A845XAC7 | 929-1134 | None |
| A0A813SLF6 | 82-388 | None |
| A0A817RV30 | 2-270 | None |
| A0A1Y2G9N3 | 182-544 | None |
| A0A819XF79 | 71-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.