DPCstruct | MC3482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04930 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QBF0 | 156-274 | DDDERPFSLTGLFDLSQISFGASMGFASGYFVKKISKTAAFLVGAVFVLLQILEHQGYIKIHWNKFEENYQKVLDLDKDGKVTANDF… |
| A0A507CFQ5 | 18-125 | SPATGQEIGLAAVMGVSSGYATKKIAKGSALVLGLTFIGFQALSHTGVIQINWNQIEKYMVARVDQDGDGKLTSRDVQLAAGRFIHL… |
| A0A7R9UZU3 | 85-208 | None |
| A0A1C7NFU3 | 73-192 | None |
| A0A7J6PPT3 | 925-1051 | None |
| G4ZJ05 | 232-356 | None |
| A0A7S3PEY4 | 2-125 | None |
| A0A7S2U881 | 11-124 | None |
| A0A5A8BZR3 | 117-231 | None |
| A0A7S2SL52 | 19-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.