DPCstruct | MC34816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 169 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6H9X7 | 51-213 | LVPGWYRVISQAGQEMPTECIRGGFRCGTTDTVWMNGTFPDAEEVKNVTACASDYNDNCCANSYDIQVKNCSGYYVYNLVPTKSCPQ… |
| A7S5P2 | 227-390 | AGNAMPTRCVPVKRCGTHAPGWMVGSHPSLRYSLVTRKVCYHWSGSCCKWSNYIKVRNCGGFYVYQLPKTPVCWLRYCGNRGSLPPP… |
| A7S1S9 | 347-512 | None |
| A0A2R8PW17 | 69-240 | None |
| A0A3M6V522 | 342-494 | None |
| A0A8B6H747 | 344-498 | None |
| A0A671LF22 | 433-598 | None |
| A0A8B6DYN0 | 69-259 | None |
| A0A6P8H8Q3 | 563-754 | None |
| A0A2B4SIC5 | 636-796 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.