DPCstruct | MC34813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818DNF6 | 1-142 | MPYTKNTYPITTFILQHLDDYSNIQHIYPIVIFTNYLIEKFNYQINRNDATEKKILYYLTKDKDKHRTNQLYNDFLHDWYSLNLKEI… |
| A0A817SNG2 | 98-231 | LPYAEKIYPVSTYLLKRLDDYTNIQHLYPIVTFSNYLIEKLNHRIKRIDAVQTKMIYYLTQDNDRDITKKLFEDFLDAWYALTFKEV… |
| A0A814QRX3 | 88-215 | None |
| A0A817MUB1 | 150-283 | None |
| A0A814D7A6 | 1-137 | None |
| A0A817J528 | 1-150 | None |
| A0A821PUE4 | 292-426 | None |
| A0A819XCS6 | 1033-1164 | None |
| A0A821JCB9 | 102-237 | None |
| A0A821NPU8 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.