DPCstruct | MC3481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 195 ± 36 aa |
| Standard deviation of domain lengths | 36.47 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF10629- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507C9L5 | 15-238 | GFIPTLGESFGHTFGIATKQILDENLSLKQGRIQKEREAAKAARRAAAKQPEHNVVWGQEKTWATGDDRFSFPPVPGYTGYIPRSKE… |
| A0A7I8WBY5 | 1-141 | MIPGYTGYIPRKPFKFGDTYKVDCDYCIDEHLRNYEKTSNDAHSLRMSSSCRPVLQAKAFDPEVRDHLNTYRDTHPRRPVMAEDKRL… |
| A0A2T7NL09 | 97-302 | None |
| A0A2H1C4H5 | 2-222 | None |
| A0A5J4NWH9 | 31-252 | None |
| A0A2I4AUF7 | 1-191 | None |
| A0A553NIS2 | 205-398 | None |
| A0A6A4JT23 | 15-306 | None |
| A0A7R9AC26 | 14-206 | None |
| A0A7R9HMH3 | 41-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.