DPCstruct | MC34807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 163 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845X7D4 | 1-124 | MTSQSPSTTGPVTLDAAGYEFLWTQLLEGAANGWDRHRMQKFFAQIEDRATIPAWLDWLGQFGKKVLASPTPNLELARRLILVATHL… |
| A0A1E5QLZ1 | 1-154 | MFRKLWQWIKQWWGRLLGRSPQPSPSEDASTSRTTRTCTDSECESLFLQLLEGVSQGWGRGRIQGYFIAKNLEESQFVEWLQRFGAP… |
| T2JX26 | 1-183 | None |
| A0A846DHZ0 | 1-152 | None |
| A0A350YDC4 | 1-191 | None |
| K9VXJ0 | 1-142 | None |
| A0A7C9PQB7 | 1-188 | None |
| A0A6P0QKN1 | 60-222 | None |
| A0A7C3ZIV0 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.