DPCstruct | MC34804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A097R7M9 | 1-56 | MMGWGKLAERGLVFRINYEILHPLGLAMAYDANTGLSSGAHVAPDGVWNFSDEVLS |
| A0A7Y8W4A4 | 1-65 | MGGCHWLDWNQLSALGLIVRVNKEILHPMGLALFRDPESGVSDGALIAPDGKWNYADDIEKGGAK |
| A0A0J2GZ48 | 109-170 | None |
| A0A7I7A6N6 | 63-123 | None |
| V3PD74 | 95-153 | None |
| A0A6M5D042 | 77-139 | None |
| A0A826R0U4 | 56-105 | None |
| A0A2M8K722 | 4-65 | None |
| A0A0N4VQL7 | 280-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.