DPCstruct | MC34803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 184 ± 35 aa |
| Standard deviation of domain lengths | 35.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4WHP2 | 200-392 | ADQFPARNMWVGFNSYYALGLGNNGANGVYHGSDGYLINVPVPQDNNFLKNIGAVRDFKENLGDTPIAVMLAPSTGYICRDKLPLIH… |
| A0A7W3H7S9 | 143-270 | EQFRGHTLISEECLSLWSKYFERIDKYTKDRNAKYLFTLAPAKELVFPDLYPHTKSNVTPVEQFLVHLNKFNIFYPLDALREAGDIS… |
| A0A2N5YUF5 | 73-276 | None |
| A0A6I1EHT4 | 139-284 | None |
| A0A1Q6QFK0 | 2-280 | None |
| A0A081BRU6 | 292-476 | None |
| A0A0P9PMM0 | 94-257 | None |
| A0A5K7ZJZ8 | 33-253 | None |
| A0A848A4Y6 | 1-152 | None |
| A0A5C8FBL2 | 3-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.