DPCstruct | MC34801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0USK8 | 3-68 | KKEYVCVNCMSPVDSLYTEYSKEVIRVTDCQKCNKVADKYIEYDPVLIFNELFLQYSTAYRHLLLN |
| A0A4P9WTW9 | 2-89 | PVCVECGASVATLYTEYGKGNIRLTKCDGPDGCGRFADKYLENDFVIVFIDMVLHRRSVYRHLLLNAPRRSDGLHRADVKWFRLEKHI |
| A0A438NE85 | 2-86 | None |
| A0A226ES34 | 3-75 | None |
| A0A1Q3DBC0 | 2-85 | None |
| A0A165X7D4 | 6-96 | None |
| A0A151HE18 | 1-75 | None |
| R9P733 | 176-287 | None |
| A0A5E4Q204 | 6-90 | None |
| A0A060RSW5 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.