DPCstruct | MC3480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 145 ± 26 aa |
| Standard deviation of domain lengths | 26.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507C1M7 | 6-144 | SSDGAADDRKQAFQIDDLVHLEDMFEELGRDDGIQDGIKDGQHEGRVAGLEQGFEMGREVGFYKSGATLWIHLIDRRPDSYPKRLTK… |
| A0A2P2JQZ2 | 3-118 | SVEDIFESSLNLEETHFNEGYKEGYQHGLATGKEEARQVGLKTGFEVGEELGFYRGCVDVWNAAIRVDPSRFSTRIQKSVKEMGGLI… |
| G2Q8L6 | 1-230 | None |
| B8C6W5 | 1-213 | None |
| A0A3Q7SSH1 | 101-223 | None |
| A0A2A4K152 | 201-331 | None |
| A0A3M6WWE7 | 2-160 | None |
| A0A194PD74 | 1-135 | None |
| A0A7S1N8V4 | 16-143 | None |
| A0A4P9WQI6 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.