DPCstruct | MC348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345XJB6 | 114-248 | PFSNRGVRYTGSSDDRALNRGVQRFDADPSAVRDLSYDSDLTGRVPIPVLTLHAADDPTAFVEHEAAYRASLEGGGSARNLVQTFTR… |
| A0A534XCE4 | 21-160 | AWGNIGVDYAAPALTPGEQLALNRGVPRASADAAGVNYMQRFFEPRGRTAAKVLTLHALDDGLVIPENDEKYREAFVASGRPEQLVQ… |
| A0A1F8R7L0 | 114-302 | None |
| A0A2V7TK30 | 17-131 | None |
| A0A838I1D5 | 100-277 | None |
| A0A1F9Z7I8 | 2-141 | None |
| I0JMF4 | 159-293 | None |
| A0A6J7SG39 | 4-162 | None |
| A0A5C6Z900 | 788-920 | None |
| A0A150P786 | 198-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.