DPCstruct | MC34795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6CCT9 | 9-153 | DRRVVDDRPRWSGAHYGGTRVHAFNVQSGVDGSGFGNPGLCCTTRHLSSYSNILHGQPGTDGWHLASTKMARFGRSSPEFCTRIKDP… |
| A0A6L9LES5 | 86-233 | FMHPRCMNCHPNGDTPLQGEDSHLHTQGVTRGPDGKGLYALKCKNCHQDNNIAGLNMPPGQPNWQMPPAHLKMIFQDKSPRQLALHF… |
| K7A131 | 38-187 | None |
| A0A366VVU3 | 46-204 | None |
| A0A5Q4GHI1 | 105-248 | None |
| A6GEC1 | 91-237 | None |
| A0A317CHJ5 | 22-171 | None |
| A0A534UJD1 | 4-127 | None |
| A0A4Q6BZR3 | 2-140 | None |
| A0A0K2G959 | 194-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.