DPCstruct | MC34794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8BU47 | 34-99 | IEPDFLVCHAGKWGVLQIVDSLKPSFDPKQERLLKFHGVKVIESFAADFCLEYPDNVVNDFLNILE |
| A0A0M4TQ64 | 7-70 | VLYEGKWGILEVDGPSHKPESRVNEQERDRLFQHNGIGIIQRFTHSKCEQHPDDVVEEFLQIIK |
| A0A480ACS6 | 465-537 | None |
| A0A218PZ40 | 226-295 | None |
| A0A6P1ZNZ5 | 1-68 | None |
| A0A2Z6CIV8 | 46-106 | None |
| A0A252CYQ2 | 22-90 | None |
| A0A846CBN6 | 180-236 | None |
| A0A1Q4REQ9 | 301-370 | None |
| A0A1U7IAP9 | 2-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.