DPCstruct | MC34793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 134 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8SYP9 | 38-160 | MSIDLDRFLRAQNLVYLQALQEVQNGKKRSHWMWYIFPQITGLGSSDTAKQYAIRDGIEAKAFLKHPVLGSNLRMLTKTFLNLQKGS… |
| A0A1X0SX60 | 2-124 | SLNRFVEAQAPVYHRALAELQAGNKQSHWMWFVFPQIAGLGSSPMAQRYAIQSLDEAKDYLAHELLGRRLAECTAAVLAHPDSTVHA… |
| A0A0P8ZY52 | 5-143 | None |
| A0A0G4HT92 | 185-342 | None |
| A0A1M6SKX3 | 150-281 | None |
| A0A1M6SKK3 | 224-347 | None |
| A0A521CQQ5 | 30-172 | None |
| A0A844Z556 | 1-76 | None |
| A0A4Q3MUN7 | 4-122 | None |
| A0A1G7VYX5 | 4-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.