DPCstruct | MC34792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 226 ± 50 aa |
| Standard deviation of domain lengths | 50.25 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8PDQ1 | 42-254 | APDESAENQLAIGQKLAVPFSKAATLLGATEDMVPAVETAYENLLAELDAHFAEHPALLGGQATIADFGLIGPLYAHLYRDPTAGKL… |
| A0A0R2UD24 | 39-244 | TLDDDSHAAFKQHISDWQTSRLWVVGSNEITAPIIEASFKRFLGQLNHCLSQHPFLFGSRPSSADYALFGQLSALVGFDPTSRALAH… |
| A0A7J6Q768 | 97-357 | None |
| A0A7J6RHQ3 | 242-494 | None |
| A0A813FJE0 | 475-703 | None |
| A0A258BUL4 | 5-165 | None |
| S9TWN1 | 144-462 | None |
| A0A4Q0YT74 | 29-229 | None |
| A0A540WU13 | 2-187 | None |
| A0A3B8Z0S1 | 379-606 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.