DPCstruct | MC3479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 357 ± 51 aa |
| Standard deviation of domain lengths | 51.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507EIQ1 | 4-319 | LQSLKSRLPSRNWCIFLGTTSTITGLAIYDKYHLRNVRKELDQKAAILANEPMQTWEVPRKVKVYVAPTHWARYWFKQYIKPVFDSA… |
| A0A507BYS6 | 24-389 | LRALGWFTGWKLPSRNWMIFYMVTSTGLALALYDTSERRKIAADFKARASPLADVPMQPSELPRRIQLYIAPSQFARYNFKEYVKPV… |
| X8JTK7 | 2-354 | None |
| A0A4P9XEP5 | 83-457 | None |
| A0A261Y361 | 794-1133 | None |
| A0A409VJM0 | 313-682 | None |
| G2YBL8 | 4-243 | None |
| A0A0G2ERV0 | 3-381 | None |
| Q5B6Z5 | 401-815 | None |
| N4X6W9 | 5-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.