DPCstruct | MC34782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0LXN6 | 18-120 | LPVFCKLYDRHEPDADVAYKPGVDAYGRPVASADLPSANQFTFPDTFSFPLTVDVIERLGLDDSHAGLEGKLGLGDVVVEQNRVSLN… |
| A0A512H5D2 | 122-227 | DCARLVAYEPGPDVAYRPGVDVHGNPVAPADLEDWSRWTGGVEKGFVLPLAIDPFAASGLSAPHGLSQPAVSIGTLAYDVASGRMTL… |
| A0A1F2Z1H1 | 14-138 | None |
| A0A2W5MS88 | 10-124 | None |
| A0A7Y0DYL4 | 64-190 | None |
| A0A081B931 | 5-118 | None |
| A0A7T9H124 | 1-109 | None |
| A0A3B1B2Y0 | 28-148 | None |
| A0A255YYA7 | 2-90 | None |
| A0A2E2WJ97 | 4-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.