DPCstruct | MC3478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 3.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 65.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561D522 | 1-82 | MIRKNDMKSSKWLQGYEQSNVIAGLSTGFKGRAQIGKGMWAMPDLMAEMLKQKIGHVKTGANTAWVPSPTAATLHALHYPEK |
| A0A1I8AGA9 | 86-166 | MLRKGDMKSTPWITAYERNNVLVGLACGLKGRAQIGKGMWAMPDLMADMLVQKIGHPKAGATTAWVPSPTAATLHALHYHQ |
| A0A3A1VWI3 | 395-473 | None |
| A0A376Y411 | 241-319 | None |
| A0A376WUS3 | 56-137 | None |
| A0A814BNM6 | 482-567 | None |
| A0A1Q9D1W1 | 353-431 | None |
| A0A6G3VSZ3 | 1-78 | None |
| A0A7J6Q8E2 | 935-1020 | None |
| A0A7S3W137 | 78-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.