DPCstruct | MC34771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 275 ± 25 aa |
| Standard deviation of domain lengths | 24.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7YDP5 | 5-285 | QTLNLIEKTNIFENSIKWIASKENEKISKLSTNEALNLIGNIIFFGNLFKNCLSVCLLDWAYLVNRILKYCAFIVTDNKKSNCWHHP… |
| A0A2C9KPB1 | 93-369 | FLLHVFSVPAVIIHIYTTAQDCIATMVTHRIFKRCLDFLTCEQSTRIIFNSLEGNYALCLMANLIQLGFVEMEGLVENTVDFMSVMI… |
| A0A811V2V3 | 45-329 | None |
| A0A0V0Z691 | 315-550 | None |
| A0A0R3T3Z9 | 139-471 | None |
| A0A158R3Z5 | 255-530 | None |
| A0A2J7RJK0 | 193-476 | None |
| A0A7G3B2A9 | 22-291 | None |
| A0A482W6Q1 | 227-468 | None |
| I7GMF8 | 253-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.