DPCstruct | MC3477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 164 ± 35 aa |
| Standard deviation of domain lengths | 34.81 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8CV90 | 171-338 | YYDSFYYLYAKRVKLIEANPAYEARNSGIFNPEYLTLNKELYLPVDKQKLPFSKYETGKLLYGNGNPLSKDYNSLSDFFVQDNNLEI… |
| A0A561CFD2 | 15-167 | VFNPIRLALNKQQTIPSTKKVIPFQDYETGVLQYGNANPASKDFDSLTDISMSKDKKVIEGRIAWQLLNVKDPSLKEVMGDIWKQGL… |
| A0A7X4Z420 | 10-107 | None |
| A0A1Y3A9N9 | 187-375 | None |
| A0A7X8ZLY6 | 361-542 | None |
| A0A7X0BA05 | 7-121 | None |
| A0A645CE39 | 30-176 | None |
| A0A1Y1VG31 | 531-698 | None |
| A0A1F2SSI3 | 710-957 | None |
| A0A538MM66 | 248-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.