DPCstruct | MC34768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 159 ± 28 aa |
| Standard deviation of domain lengths | 28.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.59 |
| Pfam Score | 41.51 |
| Assigned Pfam label(s) | CL0175- PF05764- PF08265- PF04795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7Y5W4 | 18-147 | VPENSCDPKTQRQRLEEAKNTAVQNIESLKRFEQFELERKKRQQKAIPRQILHGPRIKEMFTADGKHLVLVPELLPNEKLFPKPKKR… |
| A0A7S3RSY5 | 6-128 | RRGVELVRLTQEEILAEAAQTEIINRASLEQMLRVEEEKRKVVVRDRRTSGPRVVTKSTREGDSVRTYVTFTDGPLPPAIDDVAPDY… |
| A0A1X2G9F3 | 1-166 | None |
| A0A1C7MY76 | 152-323 | None |
| A0A2T7PSV0 | 101-267 | None |
| A0A6A5D972 | 424-612 | None |
| A0A4Y7LHH1 | 193-336 | None |
| A0A0F7SLX6 | 230-438 | None |
| A0A165PDX7 | 1-206 | None |
| F0ZV99 | 213-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.