DPCstruct | MC34767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 252 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7Y519 | 1-293 | MLLSFWHLFDIVRIIPFVEVIFNRLFSLLTISKTQELALTSLSTIVKLVNSLYVGRKSGRTILRNYIRLHFNSTIGNQTGDCETLHG… |
| A0A1S3QES5 | 83-316 | LLGLLKWRSNTSLLQQNLRQLMKVEGGEVVKFLQDTLDALFNIMMENSDSDTFDTLVFDSLVFIIGLIADRKFQHFNPVLETYIRKH… |
| A0A0C2JK57 | 116-382 | None |
| A0A452XCS5 | 359-625 | None |
| A0A452XCT6 | 2-239 | None |
| Q8SAB7 | 629-895 | None |
| A0A6G0HI57 | 235-492 | None |
| A0A175W2J9 | 809-1045 | None |
| A0A498LXS3 | 308-593 | None |
| A0A044SZE1 | 960-1202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.