DPCstruct | MC34761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 221 ± 27 aa |
| Standard deviation of domain lengths | 27.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9M0F5 | 22-250 | DTFSHIQNLIPLSSQGNKSYPTIALDTLIAEPYHHWADSDGDAKASGELRVKWENYKNIDITQQVKDNPNNVLAPCEAPYKLTLSLT… |
| A0A1B9MQU4 | 1-203 | MVGQSFIDINLMVPASFNSVNFSELVALGNWGDDDGDGQRSNEVTATGNISLKITDKYGQMVSRNDVLTKCNAPYKVELSSTGGSIS… |
| A0A853N7W5 | 4-223 | None |
| A0A1B9LNZ5 | 98-305 | None |
| A0A1B9LKV2 | 78-362 | None |
| A0A1B9KHT3 | 15-239 | None |
| A0A2V4E6E0 | 3-174 | None |
| A0A1B9ND86 | 1-230 | None |
| A0A1B9KTT9 | 131-371 | None |
| A0A1B9MWY1 | 2-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.