DPCstruct | MC3476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6DSU7 | 79-163 | ATQSNLPKQAPNRNPHPRMNAGLAVKHGILYLYGGVFEDGDKQYTLSDLYSLDLHKLEEWKTLIPCDLTSQEWLSSGSESESSES |
| A0A6A0A2I5 | 66-147 | KPKARLGAQVCVVGNVLWLFGGTIEVKDKEVTLDDMWRLDLSKMDGWDLVKENTVGEDVFKQLAGAGSSSEYETDDGGPDRE |
| A0A7S1GPI2 | 17-96 | None |
| A0A819CF63 | 135-214 | None |
| A0A1C7LLM6 | 115-213 | None |
| A0A815WB55 | 1-112 | None |
| A0A4Y7N4N5 | 9-87 | None |
| S9YJ30 | 791-891 | None |
| W7TTW5 | 525-616 | None |
| A0A182YLH3 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.