DPCstruct | MC34759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02218 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3H0N9 | 3-161 | RWWWRRTETTGRRTPTLSVHELRQNVAQDHQSIRQREDAVGAKASYGYGGRFGVEQDRMDKSALGNEYVANVAKHSSQTDAAKGFGG… |
| A0A7M3Q764 | 55-203 | AIPGTGRVGHIDMQALRESVLKQDAESKQNVIPKASYGYGGKFQVEKDRMDKSAVGHDYHEELQKHSSQQDYSKGFGGRYGVETDRQ… |
| A0A183QMJ4 | 3-132 | None |
| A0A0N0PBP3 | 2-137 | None |
| A0A6V7UYZ1 | 1-165 | None |
| A0A016UXN4 | 42-193 | None |
| A0A0N4YU26 | 51-202 | None |
| A0A0N4UNI0 | 41-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.