DPCstruct | MC34758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1ZYY6 | 158-223 | CKKKGYVETLTKRRRYLPDINSKVVPRRCAAERQAVNTTIQGSAADIVKNAMCDIAKQLEDNTQCT |
| A0A4W3GZ15 | 1-66 | MKGYVVSIMGRKRPLPHINSQDCSLRAQAERQAVNFVVQGSAADLCKMAMIKVFTCITSSSSLTAR |
| A0A4W3GZ10 | 76-142 | None |
| D7FM14 | 337-407 | None |
| A0A672YL87 | 606-670 | None |
| A0A6I9YEL4 | 33-99 | None |
| A0A4W3GV56 | 118-184 | None |
| A0A4P9VYE5 | 45-99 | None |
| A0A4Z2I3F9 | 22-86 | None |
| A0A341AF24 | 194-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.