DPCstruct | MC34757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 18.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0081 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3GWD1 | 39-172 | GKHRDTQPAAADTQPAPPEPADGNKAETAEHEGAMADTPSTPKPRRSLIRDRGPLYEDPTLPQGWARKLKQRKSGRSAGKYDVYIIN… |
| A0A7S0UPA7 | 113-239 | SPLLHESEEEDEKGGNNKTQPSIAKDLDNRSRTGASPPKRGKKTSAKVARKEPIPVWTGPPDEQIDGGWPMGWVKRVFERKSGATKG… |
| A0A4Y1RQJ5 | 2-149 | None |
| A0A7J7FT53 | 251-363 | None |
| A0A667ZQ61 | 5-158 | None |
| A0A674H6S7 | 25-193 | None |
| A0A5N5HYY9 | 1-103 | None |
| M1A6U4 | 29-150 | None |
| A0A4W4E7B1 | 40-154 | None |
| A0A1E7FW00 | 20-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.