DPCstruct | MC3475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 148 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5K4P7 | 1-138 | SCIRTEADEVTYNLHVIIRFELELELLEGALRVKELPDAWSERYERQLGVRPANHRDGVLQDMHWFSGTVGGAFQCYTLGNLMAAQI… |
| A0A6A0A128 | 1-143 | MVALSPAFCKYLLPKLQEFFPDKFAGVTAEQLYAAINKVMDPSYIRVESDEVTYPMHVIIRYEIEKGLLEGSIKVEDVPKEWNSRME… |
| A0A1E7ES51 | 4-173 | None |
| A0A5S9MF72 | 15-105 | None |
| A0A812S5M7 | 739-929 | None |
| A0A6S6S6Z7 | 1-119 | None |
| A0A0M1N078 | 41-188 | None |
| A0A2V0NUH9 | 366-511 | None |
| A0A0B7J465 | 4-128 | None |
| A0A4P6JPJ3 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.